PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA011521-PA
Common NameOsI_09856
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 919aa    MW: 101848 Da    PI: 6.1043
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA011521-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.7e-28620670252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  BGIOSGA011521-PA 620 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 670
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029609690IPR003035RWP-RK domain
PfamPF020426.7E-26622670IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.1E-25819903No hitNo description
SuperFamilySSF542771.01E-22819903No hitNo description
PROSITE profilePS5174523.255821904IPR000270PB1 domain
SMARTSM006662.0E-25821904IPR000270PB1 domain
PfamPF005641.1E-17822903IPR000270PB1 domain
CDDcd064074.00E-43822903No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 919 aa     Download sequence    Send to blast
MEQKPSPPPP PRSDEEEDGL MGCGMGGTGD IAGGDLDLME EFLLATPGLD LSEFWHPGAA  60
SPFSPLFDIG SSVTTLTTPA PAAGEDDRDE AEMPSRGGGG LEVSPAHRGW TFQTAPQEVA  120
VEPTVKERLR RALERIASQS QSQAQRGDGE LLVQVWVPTR IGDRQVLTTC GQPFWLDRRN  180
QRLASYRTVS MKYQFSADES ARADLGLPGR VFVGRVPEWT PDVRYFSTEE YPRVQHAQYF  240
DIRGSVALPV FEPRSRACLG VVELVMTTQK VNYSAEIENI CNALKEVDLR SSDVSSDPRS  300
KVVDASYRAI IPEIMDVLRA VCDTHNLPLA QTWIPCICQA KRGSRHSDES YKHCVSTVDE  360
ACYVRDCSVL GFHQACSEHH LFRGEGVVGR AFGTNEPCFS PDITTYSKTQ YPLSHHAKLF  420
GLRAAVAIQL RSVKTGSLDF VLEFFLPMKC INTEEQRAML NSLSNTIQQV CYTLRVVKPK  480
ELVNDGPFEI SQPTRPEFYA KSVHEDLDEL CSSINVPGRT TSLEASEEVS SWIASLVDAQ  540
NKGGKGEIDV DLPFGFSKQD DEGFSVTAGW HTSPVMAPDG SMFSGFKRHE DYDVKENTCS  600
SDPSNSNSDK AVEKRRTKTE KTVSLQDLRK HFAGSLKEAA KNLGVCPTTL KRICRQHGIN  660
RWPSRKIKKV GHSLKKLQMV IDSVHGPEGT VQLSSLSMKI LPRPHVPDRP CEGRFTSHTS  720
GSNSISPSCS QSSNSSLGCS SVPKTQQQHG SAPQLAVKEE ISMDENQCST LIKSASHAEA  780
ELQMFVEERP TMLFRSQSQV LLSEHKPIEN MSNVQKARSD SLKIKAIYGE ERCIFRLQPS  840
WGFQRLKEEI VKRFGISQDT HVDLKYLDDE SEWVLLTCDA DLLECIDVYK SSSNQTVRIL  900
VNPSIQPLLN ASFGQTGLS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.116550.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329852550.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000460.0AK100046.1 Oryza sativa Japonica Group cDNA clone:J013153P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629745.10.0PREDICTED: protein NLP1
RefseqXP_015629744.10.0PREDICTED: protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA2XC340.0A2XC34_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA011521-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein